PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_7C031019E.1
Common NameTRAES_3BF016200140CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 112aa    MW: 12730.5 Da    PI: 10.3223
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_7C031019E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.5e-141462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W+ eEd  l + v+++ +  +W t +++ g++R++k+c++rw++yl
  Traes_3AL_7C031019E.1 14 RGPWSREEDAVLRNFVQRFANAgNWITLPQKAGLNRCGKSCRLRWLNYL 62
                           89******************999*************************7 PP

2Myb_DNA-binding44.73e-1469111246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T+eEd l++ +    G++ W+ Ia++++ gRt++++k++w++
  Traes_3AL_7C031019E.1  69 GGFTEEEDSLILSLYGDIGSR-WSVIAAKLP-GRTDNDVKNHWNT 111
                            569******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5009010.801962IPR017877Myb-like domain
SuperFamilySSF466891.0E-2711109IPR009057Homeodomain-like
SMARTSM007178.8E-81364IPR001005SANT/Myb domain
PfamPF002497.6E-121462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-211569IPR009057Homeodomain-like
CDDcd001671.19E-51662No hitNo description
PROSITE profilePS5129419.26263112IPR017930Myb domain
SMARTSM007171.5E-667112IPR001005SANT/Myb domain
PfamPF002491.0E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2070111IPR009057Homeodomain-like
CDDcd001671.08E-971111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MGRSPCCDKA SVKRGPWSRE EDAVLRNFVQ RFANAGNWIT LPQKAGLNRC GKSCRLRWLN  60
YLRPALRHGG FTEEEDSLIL SLYGDIGSRW SVIAAKLPGR TDNDVKNHWN TK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141117102B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-67HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008675095.12e-71PREDICTED: myb-related protein Zm38-like
SwissprotQ9FKL26e-62MYB36_ARATH; Transcription factor MYB36
TrEMBLW5CE453e-79W5CE45_WHEAT; Uncharacterized protein
TrEMBLT1N5S12e-78T1N5S1_TRIUA; Uncharacterized protein
TrEMBLA0A077RU423e-78A0A077RU42_WHEAT; Uncharacterized protein
STRINGGRMZM2G167829_P016e-71(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-63myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]